General Information

  • ID:  hor000475
  • Uniprot ID:  A0A6J1WKA0
  • Protein name:  Bom-AST-7
  • Gene name:  LOC113512098
  • Organism:  Galleria mellonella (Greater wax moth)
  • Family:  Allatostatin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Galleria (genus), Galleriinae (subfamily), Pyralidae (family), Pyraloidea (superfamily), Obtectomera, Ditrysia, Heteroneura (parvorder), Neolepidoptera (infraorder), Glossata (suborder), Lepidoptera (order), Amphiesmenoptera (superorder), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  NA

Sequence Information

  • Sequence:  LSSKFNFGL
  • Length:  9(184-192)
  • Propeptide:  MLYSSLPVCLLLIGVAFCAPEQIQSEPETPTHEDPSTNNIEYTASLEKRSPHYDFGLGKRAYSYVSEYKRLPVYNFGLGKRSRPYSFGLGKRSVDEDQISEFNNDVDQTDLAAFLDQYDDAPVYEEKRARPYSFGLGKRNAENDISEEKRGRMYDFGLGKRLPMYSFGLGKRARSYNFGLGKRLSSKFNFGLGKRERDLHRFNFGLGKRSADDTSNDDSVNYFDV
  • Signal peptide:  MLYSSLPVCLLLIGVAFC
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A6J1WKA0-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000475_AF2.pdbhor000475_ESM.pdb

Physical Information

Mass: 115504 Formula: C48H73N11O13
Absent amino acids: ACDEHIMPQRTVWY Common amino acids: FLS
pI: 9.7 Basic residues: 1
Polar residues: 4 Hydrophobic residues: 4
Hydrophobicity: 42.22 Boman Index: -225
Half-Life / Aliphatic Index: 5.5 hour Aliphatic Index: 86.67
Instability Index: 1358.89 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  15706623
  • Title:  Mass Spectrometric Analysis of Head Ganglia and Neuroendocrine Tissue of Larval Galleria Mellonella (Arthropoda, Insecta)